PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NF-YB
Protein Properties Length: 134aa    MW: 15544.2 Da    PI: 4.5038
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005230genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB142.31.2e-4412100795
      NF-YB   7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                +lPianv+rimkk+lP++akisk+ak t+qec+sefisfvtsea++kc++e+r+t+ngdd++wa+++ G+++y+e  ++yl kyre+e+
  Cla005230  12 ELPIANVGRIMKKILPQKAKISKEAKTTMQECASEFISFVTSEAAQKCHKENRRTLNGDDICWAFGSYGLDNYAEISEKYLLKYREVER 100
                69*************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-448132IPR009072Histone-fold
PfamPF008081.9E-261275IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.95E-3312129IPR009072Histone-fold
PRINTSPR006154.1E-144058No hitNo description
PRINTSPR006154.1E-145977No hitNo description
PRINTSPR006154.1E-147896No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MGDQHNGDEF VELPIANVGR IMKKILPQKA KISKEAKTTM QECASEFISF VTSEAAQKCH  60
KENRRTLNGD DICWAFGSYG LDNYAEISEK YLLKYREVER IKADQYKCKI TQQLQQGEEE  120
DDDDDDEQEH NNQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-341397892Transcription factor HapC (Eurofung)
4g92_B2e-341397892Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818061e-111LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
GenBankLN7132561e-111LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451142.11e-64PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040275e-44NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0A0LW128e-57A0A0A0LW12_CUCSA; Uncharacterized protein
STRINGSolyc01g099320.2.11e-47(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-45nuclear factor Y, subunit B4